| Catalog No. |
TD-RP11344 |
| Description |
Potent endogenous opioid protein β-Endorphin is derived from propiomelanocortin. β-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. β-Endorphin is released in response to painful stimuli and has potent antinociceptive activity mediated through its action on μ receptors in brain and by μ and κ receptors in the spinal cord. |
| Cas No |
61214-51-5 |
| Sequence |
{TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{TYR}{LYS}{LYS}{GLY}{GLU} |
| Sequence Shortening |
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
| Molecular Formula |
C₁₅₈H₂₅₁N₃₉O₄₆S |
| Molecular Weight |
3465.1 |
| Purity |
> 95% |
| Solubility |
Soluble in Ultrapure water under 1mg/ml |
| Form |
Lyophilized |
| Storage |
Store the peptide at -20°C |