| Catalog No. |
TD-RP30247 |
| Description |
β-Amyloid 1-42 is one of the major constituents of the neurofibrillary tangles and plaques characteristic of the Alzheimer brain. The Arctic mutation E22G causes early onset of Alzheimer′s compared to wild type and promotes protofibril formation and neurotoxicity. |
| Sequence |
{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Gly}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}{Ile}{Ala} |
| Sequence Shortening |
DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA |
| Molecular Weight |
4442.00 |
| Purity |
>95% |
| Solubility |
Soluble in 3% ammonia water under 1mg/ml |
| Form |
Lyophilized |
| Storage |
Store at -20°C. Keep tightly closed. Store in a cool dry place. |
| Note |
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden. |