| Catalog No. |
TD-RP30250 |
| Description |
β-Amyloid peptides are the major constituents of senile plaques and neurofibrillary tangles that occur in the hippocampus, neocortex, and amygdala of patients with Alzheimer′s disease. Aβ (1-40) whether soluble or insoluble differentiates AD vs high pathology controls. The Arctic mutation E22G causes early onset of Alzheimer′s compared to wild type and promotes protofibril formation and neurotoxicity. |
| Sequence |
{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Gly}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}
|
| Sequence Shortening |
DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV |
| Molecular Weight |
4257.76 |
| Purity |
>95% |
| Solubility |
Soluble in Formic acid under 1mg/ml |
| Form |
Lyophilized |
| Storage |
Store at -20°C. Keep tightly closed. Store in a cool dry place. |
| Note |
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden. |