| Catalog No. |
TD-RP30251 |
| Description |
This is a fluorescent 5-FAM-labeled β-Amyloid (1-40), Abs/Em=492/518 nm. FAM is preferred over FITC because of its photo- and chemical stability. |
| Sequence |
{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val} |
| Sequence Shortening |
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| N Terminal |
5-FAM |
| Molecular Weight |
4688.13 |
| Purity |
>95% |
| Solubility |
Can be dissolved in 3% ammonia water. |
| Form |
Lyophilized |
| Storage |
Store at -20°C. Keep tightly closed. Store in a cool dry place. |
| Note |
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden. |